Opsin evolution: key critters (cnidaria): Difference between revisions
Tomemerald (talk | contribs) |
Tomemerald (talk | contribs) |
||
| Line 298: | Line 298: | ||
The unpublished observation of phototaxis in Trichoplax is only weak supportive evidence for opsins because demosponge larva also exhibit phototaxis (shadow seeking under coral rubble) whereas the action spectrum fits a flavin or carotenoid chromophore better than retinal. Larval photoreceptors don't reside in a rhabdomeric or ciliary morphological setting but rather in ring of columnar monociliated epithelial cells. No expression staining has been conducted for the putative opsins -- Trichoplax has only 4 cell types, none specialized in appearance to photoreceptor. | The unpublished observation of phototaxis in Trichoplax is only weak supportive evidence for opsins because demosponge larva also exhibit phototaxis (shadow seeking under coral rubble) whereas the action spectrum fits a flavin or carotenoid chromophore better than retinal. Larval photoreceptors don't reside in a rhabdomeric or ciliary morphological setting but rather in ring of columnar monociliated epithelial cells. No expression staining has been conducted for the putative opsins -- Trichoplax has only 4 cell types, none specialized in appearance to photoreceptor. | ||
Cryptochromes are another well-known alternate photoreceptive system in bilatera with no homology at the protein level to opsins. In all kingdoms of life, [http:// | Cryptochromes are another well-known alternate photoreceptive system in bilatera with no homology at the protein level to opsins. In all kingdoms of life, [http://www.ncbi.nlm.nih.gov/pubmed/14730990? only seven known families of proteins] transduce light into signals (opsins, cryptochromes, phytochromes, xanthopsins, phototropins, BLUF, and LITE); Trichoplax would have to be evaluated for each of these too. For example, nematode C. elegans lacks opsins and cryptochromes but has a shorter wavelength photoresponse bypassing cAMP and diacylglycerol (DAG) downstream signalling that neurons commonly use to control behavior. The [http://biology.plosjournals.org/perlserv/?request=get-document&doi=10.1371/journal.pbio.0060198 primary photoreceptor LITE1 (NP_509043)] is a 8-transmembrane member of the invertebrate gustatory receptor family (non-GPCR). | ||
Trichoplax could have an unobserved larva and metamorphosis in view of the proposed post-sponge position. Alternatively, it may have be a direct developer or have lost the ability to reproduce other than by fission (which is contradicted by meiosis genes, oocytes and population genetics despite non-observation of male gametes). Trichoplax has never been observed directly in the wild -- instead it is collected on submerged alga-coated microscope slides (or aquarium walls). Whole aspects of its life cycle may go undetected in labratory culture. The current situation -- highly conserved genome, highly derived morphology, post-sponge divergence -- is an odd mix. | Trichoplax could have an unobserved larva and metamorphosis in view of the proposed post-sponge position. Alternatively, it may have be a direct developer or have lost the ability to reproduce other than by fission (which is contradicted by meiosis genes, oocytes and population genetics despite non-observation of male gametes). Trichoplax has never been observed directly in the wild -- instead it is collected on submerged alga-coated microscope slides (or aquarium walls). Whole aspects of its life cycle may go undetected in labratory culture. The current situation -- highly conserved genome, highly derived morphology, post-sponge divergence -- is an odd mix. | ||
Revision as of 19:07, 26 August 2008
Cnidaria .. 1 opsin established
Biologists have belatedly realized that many molecular and morphological innovations attributed to chordates (or grudgingly to bilatera) actually track back much earlier to the common ancestor with cnidaria (Eumetazoa) if not earlier still to sponges or choanoflagellates. That's certainly true of photoreception. Two cnidarian genome projects have been more or less finished (Nematostella and Hydra) but that selection needs to be seriously expanded. Hydra especially repeats the whole mistake of sequencing a hugely derived genome with relatively little applicability to Bilatera based on a shallow 'model organism' approach (Hydra has only 66 publications in the last 30 years).
A scientifically neutral definition of eye needs to embrace the full variety of photoreceptors, including those with fewer "features" than the most complex. Probably the cutoff should be based on use of bona fide opsins classifying to the root of the encephalopsin, melanopsin, and RGR families covalently binding retinal and variants as agonist. Some purposes for an eye can be fully met by just perceiving and acting upon one "pixel", that is a simple photoreceptor eye with no pigment cup (that could provide directionality, two pixels resolution). Far too much emphasis has been given to the distinctness of lensed vision whereas such systems are evidently easily evolved and only a part of a broader photoreceptor continuum.
We don't say humans lack eyes just because a redtailed hawk has more pixels; we don't say humans lack color vision just because a turtle sees richer, sharper colors. When a simpler photostructure already suffices to distinguish day from night for gamete release, up from down for settlement, towards or away for predator evasion, cornea, lens, retina, and centralized nervous system are just baggage that can't be developed or maintained under darwinian selection. Cnidarian eyes exemplify this full range of possibilities.
Sponges and cnidarians have operated for immense timescales under selective pressure on huge population numbers on a steady body plan. Rather than frozen in time at some primitive condition as often portrayed (biobigotry), quite the opposite, they are fast evolvers that have had eons to perfect their genes and expression systems even as mammals played evolutionary catchup (eg human knee or defective LWS opsin duplication).
No living animal represents a long-gone ancestral node -- evolution never stops at the dna level even if outward morphology seems constant. All extant species have proven equally successful at survival. Evolution is not a story book progressing to human-- if cnidarians are so dumb and their vision so bad, how then are they able to chase, catch, kill, and eat advanced vertebrates?
Cubozoa: Tripedalia cystophora (jellyfish) .. 1 opsin
A landmark paper by Kozmik et al in the 24 June 089 PNAS has found the first convincing camera-eye imaging opsin sequence in pre-Bilatera, accompanied by homologous genes needed for the signaling cascade and melanin formation. That opsin classifies deeply within deuterostome TMT- and encephalopsin-class cilary opsins, just as expected (should such an opsin even exist in cnidarian photoreception) because pineal and retinal opsins descended via gene duplications from this ancient opsin class (which also has non-imaging representatives in protostomes) prior to lamprey divergence.
This new gene has the expected 7-transmembrane topology, conserved disulfide, ERY domain (as ERF), and conserved lysine for covalent chromophore attachment (with counterion predicted here at the ancestral 'E181' position EGV). Only the lysine and counterion are specific properties of opsins relative to generic rhodopsin-class GPCR. Other conserved residues specific to ciliary opsins serve to distinguish it from rhabodomeric opsins and contribute to its unequivocal blastp clustering within vertebrate ciliary opsins. These latter are slow-evolving and consequently the distance is less than to protostome ciliary opsins.
The authors suggest the NKQ motif (NRS in Tripedalia) at the start of the last cytoplasmic region is a reliable signature for ciliary transducin interaction (this was established experimentally as a contributing factor but only for bovine RHO1 and its co-evolving transducin Gt) but comparative genomics of 300 phylogenetically dispersed opsins shows this cannot hold in general as TMT opsins lack the basic middle residue and encephalopsins do not conserve the motif at all. Note rod and cone transducins cannot be tracked back orthologously even to tunicates. Melanopsins are not known from pre-Bilatera; at some point they coalesce with ciliary opsins, perhaps with this motif coelescing to the latter's pattern. Opsins can also trigger multiple signaling systems.
Tripedalia and its still-hypothetical Gt transducin have been co-evolving on a separate trajectory from the bovine pair for perhaps 1.2 billion years. The histories of gene duplication in the heterotrimeric G proteins may differ, along with the constraints in vertebrates of transducin having to simultaneously interact with multiple ciliary opsin genes. However as initial gene duplicates, Gt and Gq would have had the same binding site; even as the proteins differentiated to serve distinct opsin sets, the binding site (at the juncture of last transmembrane and last cytoplasmic sections) would likely remain conserved because of homologic inertia of the binding pocket and the implausibility of creating a new transduction mechanism.
It is easy enough to identify candidates for the photocascade alpha subunit of heterotrimeric G protein in cnidaria -- simple Blast of human GNAT2 protein (cone transducin) calls up two strong 64% identity matches in Nematostella, Hydra, and others (meaning the binding site could be accurately modelled). These could be close relatives of the implied Tripedalia ciliary opsin transducin for which there is no data, but exclusive staining data would needed to make the case.
Actual ciliary opsin conservation in this boundary region looks like yNP.IY..mNkqFr.c (YNPVIYCLLNRSFRKM in Tripedalia) with the serine of NRS not observed in other species; the logos graphic shown below makes this quantitative. Note while this region looks very different in melanopsins (typically HPK in HNPIIYAITHPKYRM), there was never any potential for confusion given the much worse alignment there. The cubomedusan opsin also appears oddly truncated at the carboxy terminus; it appears to lack the cysteines need for palmitoylation and the serines/threonines for kinase activation.
Alignment of new cnidarian opsin with best Blastp in reference collection, compared to consensus sequence of all known ciliary opsins. triCys 47 SFLLNGLVIAVLIKYIRTITNTNIIVLSMSCANILIPLLGSPLSATSSLMRKWQFGNGGCTWYGFINTLSGISGIYHLTFLSFERFITIVLPLKRDTILSTKNIYIGLGILWVAAIGVAGAPVFGWCEYIKEGVRTSCSVAW bestBl +F +NGLVI V +KY + + N I+++++ AN+L+ + GS +S +++++ + G C + GF+ +L+GI G++ L +FER++ I P+ D K+ +G WV + P+FGWC Y+ EG+RTSC consen n............Lr.p.n..l.n...........g..........g....g...C...gf.....G......l.....eR......p...........a.......W........pPl.GW..y..eg....C.... xenTro 43 AFFVNGLVIVVTLKYKKLRSPLNYILVNLAIANLLVTIFGSSVSFSNNVVGYFFMGKTMCEFEGFMVSLTGIVGLWSLAILAFERYLVICKPMG-DFRFQQKHAILGCSFTWVWSFIWTSPPLFGWCSYVPEGLRTSCGPNW triCys -SSKENMNVFSYNLFMIFTVFLLPMLVIIYCNYRFIKEVSIMSTRARGLQGGDSEMTASASKAEKQLTIMVITMIIAFNIAWLPYTVVSMVFLTGYGDVVGPMGASVPSVFAKTSVIYNPVIYCLLNRSFRKML-----CGNS 325 bestBl + N N SY + + T F++P+ II+ +Y + +M+ RA Q DSE T +AEK++T MVI M++AF I WLPY ++V+ P AS+PS F+KT+ +YNP+IY +N+ FR L CG S consen ..........sy.....f.....P...i....Y..............................E..v..Mv..Mv..f...w.PY......................P....K....yNP.IY..mn.qfr........CG.. xenTro YTGGTNNN--SYIMALFLTCFIMPLSTIIF-SYSNL----LMALRAVAAQQKDSETT---QRAEKEVTRMVIAMVLAFLICWLPYASFAVVVAVNKDVVIEPTVASLPSYFSKTATVYNPIIYVFMNKQFRNCLMTLLCCGRS 316
The low overall percent identity (37%) of its best matches to any known Bilateran opsin, attributable to the great evolutionary time spans involved, disappointingly does not open any new doors. The sequence here does not have striking homololgy to cnidarian opsins recently proposed by several other groups, does not elicit dramatic new ones in sequenced cnidarian genomes or transcript programs, nor serve to locate opsins in sponge genome.
Note the other phototransduction cascade proteins co-located in the rhopalia by the authors have much more striking percent identity to both Nematostella and human homologs than the opsin, most astonishingly PDE6D at 80%. In terms of human gene names, function, and associated disease:
OCA2 49% EU310502 melanocyte membrane transporter of melanin precursor tyrosine (ocular and cutaneous albinism) MITF 48% EU310499 basic helix-loop-helix and leucine zipper transcription factor (auditory+pigmentary syndromes) PDE5A 48% EU310500 cGMP-specific phosphodiesterase 5A PDE6D 80% EU310501 cGMP-specific phosphodiesterase subunit delta recognizing prenylation GUCY2F 48% EU310503 rod outer membrane guanyl cyclase resynthesis of cGMP for recovery of the dark state
Most curiously, the authors observe that the major Tripedalia lens crystallin J1 protein is also strongly expressed in the nominally lensless slit and pit eyes. This raises the question of whether our concept of lens is too anthropomorphic and whether other anatomical configurations of high refractive index proteins can accomplish the same ends, possibly requiring an 'upgrade' for slit and pit eye functional assessment. For example, cone megamitochondria in treeshrews (refractive index 1.4) may have some lensing or waveguide function.
The opsins of slit and pit and larval eyes (implied by their photoreceptor cell structures) need to be determined with high priority. What's needed here too is a massive ortholog sequencing effort in the 19 extant species of cubozoan to break up isolated opsin long branch to show how such sequences are evolving, allow estimation of when they were recruited to imaging vision and reconstruct the earliest such ancestor. If a rhabdomeric opsin also occurs in larval or other eyes, that too needs comparative genomics.
It's unclear whether the last common eumetazoan ancestor of Tripedalia and Bilatera had imaging vision (note the hydozoan Cladonema radiatum has eyes and sponge larva have photoreceptor structures), yet clearly that ancestor contained one or more ciliary-type rhodopsin-class 7TM GPCR from which ciliary opsins descended in both clades, not always to be recruited for imaging. The fossil record for cubozoan cnidaria predates the Cambrian, though when eyes and statocysts (both regulated by PAXB) first appeared is unclear. Note further that planaria larva of Tripedalia have a rhadomeric photoreceptor, suggesting melanopsin photoreception is also very ancient.
It's worth noting that the phylogenetic tree for early metazoans has entered a state of turmoil. Sponges may be secondarily simplified in the adult stage; ctenophores may be basal, and so forth. It's even been suggested that ancestral sponge larva represent the central object from which complex metazoan are descended.
These considerations suggest a very early evolutionary origin for the basic genes of photoreception and their regulation, with a great many lineage-specific subsequent upgrades and downgrades of the details, deuterostomes being the last to get on board with imaging vision. Thus the question Darwin asked, how many times did vision originate, requires a more nuanced answer than just a number. Most likely, the basic package of photoreceptor genes and their developmental regulation of expression arose just once, with all subsequent systems descended from that. However that package was subjected to numerous gene duplications and morphological variations in deployment, and ouside recruitment in the case of crystallins and pigments.
Protostomes recruited melanopsin-class opsins for their imaging vision (despite available retained ciliary opsins), whereas early deuterostomes lacked imaging vision per se but retained ciliary opsins in related photoreceptory roles. Later post-amphioxus, post-tunicate deuterostomes independently recruited a descendent ciliary opsin (despite an available retained melanopsin-class opsin), moving from pineal to bilateral imaging eyes in the third and latest invention of imaging vision.
The spectral sensitivity of neritic (near-shore) lens eyes of a box jellyfish, Tripedalia cystophora previously considered by M Coates et al was interpreted as a single vitamin A-1 based opsin with peak sensitivity near 500 nm (blue-green). However nothing was sequenced. This species was most helpfully reviewed earlier by Piatigorsky and Kozkmik who note Eakin already commented on seemingly ciliary photoreceptors in 1962. However, 45 years later we still didn't know if opsins in cnidarians would classify with vertebrate ciliary opsins. They could even share conserved intron positions though that cannot be determined from transcript data.
Furthermore, as noted by Nordstrom et al, planula larvae of Tripedalia have a series of single-cell pigment cup rhabdomeric-like photoreceptors directly connected to motor cilia. These lack neural connections in line with Gehring's notion of the eye preceding the brain in evolution, rather than being a later add-on. So cnidaria might actually retain descendents of both types of ancestral opsins. No sequence is available yet for larvae,
Cubozoa: Carybdea marsupialis (jellyfish) .. 0 opsins
Cnidarians are the earliest diverging invertebrates with multicellular light-detecting organs, called ocelli. Photodetectors include simple eyespots, pigment cups, complex pigment cups with lenses, and camera-type eyes with a cornea, lens, and retina. These remarkable eyes are located on sensory clubs called rhopalia with four lining the bell. Each houses six eyes: a pair of pit ocelli, a pair of slit ocelli, and two unpaired lens eyes with counterparts to cornea, cellular lens and retina of ciliated photoreceptors. Anatomically, ocelli have bipolar sensory photoreceptor cells interspersed among nonsensory pigment cells with the apical end making the light-receptor and the basal end forming an axon that synapses with second-order neurons to form what amounts to ocular nerves.
The most striking jellyfish from the perspective of a complex set of eyes is Carybdea marsupialis, as reviewed by VJ Martin. Antibody studies based on vertebrate cone/rod opsins are doubtful because of cross reactivity to generic GPCR proteins; again no opsins have been sequenced yet. This would make a great genome to study provided the retroposon and base composition are not unwieldy. Nematostella and Hydra, whatever their other genomic merits, sit in the Anthozoa and Hydrozoa respectively, types of cnidarian lacking elaborate visual systems.
Vision has roles in the reproduction and feeding of cubomedusae which can find each other and chase, catch, and eat teleost fish. A patch of Pelagia nocticula 10 square miles in extent and 35 feet deep recently destroyed a salmon farm off Northern Ireland.
Anthozoa: Nematostella vectensis (sea anemone) .. 0 opsins
The Nematostella genome has been released along with major papers and an upgrade to Stellabase. Not all 6.1 million traces were used up by the assembly, so any gene missing from the assembly should be sought directly in the trace archives.
The sea anemone, an anthozoan within Cnidaria having epithelial cells, neurons, stem cells, complex extra-cellular matrix, muscle fibers, and symmetry axis, is emerging as a high-profile evo-devo model species to elucidate the emergence and deployment of genes that determine animal body plans. However those plans don't seem to include eyes or overt photoreceptor structures such as pigment cells -- for that cubomedusae would be far better. PAX6 and RX are especially relevent to photoreceptor structures; their expression has been thoroughly studied in Nematostella without uncovering any sensory system though they contribute to patterning specific components of the ectodermal nerve net.
The JGI annotation pipeline produced a number of extensively annotated gene models for Nematostella opsins. These are available simply by keyword lookup, tblastn of various queries the best of which turn out to be -- unsurprisingly -- an encephalopsin subclass from Branchiostoma. It is important to credit the JGI staff for providing the relevent bioinformatic track computations because they were first to characterize and release these opsins into the public domain (eg GenBank NR and Entrez Gene). It does not constitute independent "discovery" to perform keyword lookup and copy out other peoples' work. Without proper citation, that's plagiarism.
I extended improperly truncated JGI gene models (ie those lacking iMet and stop codon), validated the extensions still lacked introns (GT-Ag splice junctions missing at positions expected from closest homologs), placed the best 3 (of a half dozen) in the Opsin Classifer with fasta headers, noted their best matches below, and validated lysine and counterion glutamate in the expected positions. All this is consistent with (but does not prove) a role for ciliary Gt opsins in pre-Bilateran photoreception. Nematostella transcripts contain
We expect cnidarians (maybe not this particular anthozoan) to have both melanopsins and encephalopsins. Our tendency is to think that imaging eye opsins, whether insect rhabdomeric or vertebrate ciliary, are the main attraction, with the other opsins playing out obscure roles in secondary functions like timing of gamete release . That's quite wrong-headed. Deeper gene family trees show that the melanopsin and encephalopsin constititue the primary photoreceptors. Over vast evolutionary time scales, they gave rise to various spin-offs in various clades at various times through gene duplication and subsequent neofunctionalization. At even greater phylogenetic depth, melanopsin and encephalopsin are themselves related by gene duplication. As noted by Arendt, that exploited gene duplication within the alpha subunit of heteromeric G protein and profound diversification in signalling system second messaging.
The odd thing about all these cnidarian encephalopsins is their lack of introns (three ancestrals are expected). That's very unlikely to be the Eumetazoan ancestral state for encephalopsin because Nematostella is no rogue organism when it comes to intron conservation. A common explanation for this within eukaryotic bioinformatics is gene duplication of a master gene via fully processed retrogenes (rather than through tandem, segmental, chromosomal, or whole genome duplications -- all of which preserve introns). Mixed mechanisms are also common (as in olfactory receptors): an initial intronless retrogene is duplicated tandemly etc. These paralogs can even displace the master gene by taking over its function, causing it subsequently to be displaced or even lost. That scenario played out within zebrafish opsins.
If so, we might expect Nematostella encephalopsins to be more closely related to each other than any known opsin from any species. Indeed ENCEPHa_nemVec is 90% identical to ENCEPHb_nemVec and 52% with ENCEPHc_nemVec, whereas only 39% identical to the best bilateran opsin, ENCEPH4_braFlo of amphioxus. Those are profound differences -- mammalian proteins typically take 100 myr to lose 10% of their percent identity. Here though we know next to nothing about clade-specific rates and have very long branches indeed. Of course, a seven-transmembrane protein has very different evolutionary constraints from the generic globular cytoplasmic protein to which off-the-shelf phylogenetic software is tuned, so no purpose is served applying that.
It appears the three Nematostella proteins may share a distinctive rare genetic event, an indel in a loop region. That would favor a common history. It will prove difficult to resolve indels as to insertion or deletion for lack of suitable outgroup.
Given an finished genome, the mode of gene amplification can be explored by looking at flanking genes. Perhaps ENCEPHa_nemVec and ENCEPHa_nemVec are adjacent (ie tandem duplication) or perhaps their flanking genes are paralogous (syntenic segmental duplication). However the Nematostella genome is currently unfinished and the (gapless) contigs containing the encephalopsins run about 10 kbp. Depending on gene density that can be too small to establish synteny. These contigs, separated by strings of N's of unknown length, are further assembled into larger scaffolds (ample for synteny), a process usually trustworthy at highly experienced JGI but sometimes confounded by issues such as repeats, compositional simplicity, very recent duplicative regions, and clonability.
The most convenient approach here is tblastn of ENCEPHa_nemVec against the wgs menu item at NCBI Blast, specifying Nematostella. The three genes here are on different scaffolds altogether, ruling out tandem position. The nearest flanking genes can be extracted by blastx of the enveloping contig (or whole scaffold) against GenBank protein. JGI has in effect already done this, as could be seen by expanding out from the inital browser view. Comparing 3 browser views is complicated by the fact that flanking paralogs might be named differently, but that is readily overcome by collecting sequences (noting strand orientation) into a mini-database and comparing within uBlast.
Notice the Opsin Classifier collection already contains the outcome of this process as a fasta header field (for deuterostome opsins). It is conceivable that orthology of a Nematostella opsin to say a Branchiostoma opsin could be established in this way (synteny). However gene order in both genomes has been independently scrambled over immense time scales and orthology would have been to the Nematostella master gene (with introns) that appears lost. It's better to build out from a local synteny chain but that requires data from additional cnidaria. Note the irony here in that the farther removed the genome from human, the more densely they must be sampled.
It's evident from a casual ClustalW alignment, after marking up columns for membrane-spanning sections and considering hydrophobicity, that Nematostella opsins conform to the standard central pattern. That's unsurprising since proteins retain 3D structure at far lower percent identity and the pattern here cuts much deeper, into the overall rhodopsin superfamily and beyond to generic GPCR. However encephalopsins can have very considerable extensions at their amino and especially carboxy termini that need separate consideration.
For now, sequences can be trimmed to whatever is alignable across the full spectrum of ciliary opsins. Recall that by design the Opsin Classifier collection seeks maximal phylogenetic dispersion to mitigate over-weighting by over-studied species that might introduce clade-specific interpretive bias. That could also be done by distilling the dataset down to ancestral sequences at lamprey divergence, the risk there being co-evolution of non-adjacent residues (eg different alpha helices) can be lost in residue-by-residue ancestral reconstructions.
As noted, Nematostella opsins are at best 39% identical. These had better be strongly concentrated at invariant and near-invariant ciliary opsin positions rather than randomly distributed. Blastp of course doesn't know the difference. We know at the outset this strong association will occur for any GPCR to the extent that it is reliably alignable, so the question really is whether conservation is concentrated at the conserved positions specific to ciliary opsins (ie conservation not shared with Go and Gq opsins). This has all been studied before but not nearly at the phylogenetic depth made possible by comparative genomics. There is always a need in remote opsins for independent support (here stratified signature residues) of candidates suggested by blast searches.
For that, it is most convenient to cut conservation tranches with Corpet's Multalign because user-specifiable line width can set breaks after structurally meaningful locations. Here the cutoff for invariant is set variously at 100%, 95%, 90%,... (with Nematostella omitted) and the stack of consensus lines retrieved. That results in a nuanced version of invariance that can be set off against the Nematostella sequence at those positions. For "controls" rhabodomeric opsins, rhodopsin superfamily, and generic GPCR generate their own stacks. (Alternatives such as logos or the misnamed evolutionary trace would give similar outcomes. None of the methods make use of the known phylogenetic tree relating the sequences.) The bottom line here will be that these new cnidarian opsins will have conserved residue signatures specific to a conventionally functioning ciliary opsin, though ultimately that can only be tested by experiment.
>ENCEPHa_nemVec Nematostella vectensis (anemone) no cdna complete 1 exon 306 aa best:ENCEPH4_braFlo scaffold_465_Cont27987 alt: Nemve1:219988 Nem1 >ENCEPHb_nemVec Nematostella vectensis (anemone) NC-extended 1 exon 275 aa best:ENCEPH4_braFlo scaffold_273_Cont21871 alt:Nemve1:130042 Nem3 >ENCEPHc_nemVec Nematostella vectensis (anemone) C-extended 1 exon 289 aa best: ENCEPH5_braFlo scaffold_11_Cont2404alt: Nemve1:85309 Nem2 ENCEPH4_braFlo Branchiostoma floridae (amphioxus) Gt 0.... 470 7.0e-48 39% identity to ENCEPH4_braFlo ENCEPH4_braBel Branchiostoma belcheri (amphioxus) Gt 0.... 449 1.2e-45 PER_xenTro Xenopus tropicalis (frog) ?? 0.2.0.2.1.0... 438 1.7e-44 ENCEPH4a_takRub Takifugu rubripes (teleost) Gt 0...2...0... 435 3.6e-44 PER_homSap Homo sapiens (human) ?? 0.2.0.2.1.0.1 in... 426 3.2e-43 ENCEPH4b_takRub Takifugu rubripes (teleost) Gt 0...2...0... 418 2.3e-42 ENCEPH5_braFlo Branchiostoma floridae (amphioxus) Gt 0.... 418 2.3e-42 ENCEPH_gasAcu Gasterosteus aculeatus (stickleback) Gt ... 415 4.7e-42 PER_monDom Monodelphis domestica (opossum) ?? 0.2.0... 411 1.2e-41
Four putative opsins have been proposed by Plachetzki et al. Accessions of the supporting gene models are given in the JGI protein ID system (non-GenBank) as Nematostella1 219988, Nematostella2 85309, Nematostella3 130042, and Nematostella4 108738 (or fragments in the alignment graphic allow recovery of the respective cdnas by tblastn of GenBank WGS). As noted in the Hydra section, multiple lines of evidence are necessary to establish the first bona fide opsins in cnidarians.
There appear to be 2 Nematastella opsin-like cdnas at GenBank that cannot be found in the genome assembly or trace archives, DV091537 and DV087469. While genes can be missing from first assemblies, it is bizarre for both to be missing considering coverage is 6x. Upon back-blast to GenBank nr or the Opsin Classifier, very strong matches are seen consistently within crustacea. Thus it appears that these Sars Institute products are contaminants from another species, possibly a brine shrimp widely used in aquarium food. It is not unusual to see transcript (at issue here) and genome projects contaminated with dna from other species such as commensals, parasites, and food source -- this is reminiscent of Xenoturbella being confused with a mollusc in its diet.
New Nematostella transcripts continue to be posted by JGI into mid-Dec 2007. Using proxies for all possible queries, I located a possible melanopsin and possible rhabdomeric LWS counterpart, The former had two coding exons but not at a melanopsin position; the latter had but one. These are fairly weak matches and further characterization is needed. They're stored in the Opsin Classifier as MEL_nemVec and LWS_nemVec2.
A third group has taken a serious look at photoreception in Nematostella. No paper or dissertation has emerged as yet; no cnidarian opsins have been posted to GenBank.
The claim of orthology will prove exceedingly difficult to establish in a 700 million year long branch. It is not a property of a gene tree per se. By definition, two genes in species A and species B are orthologous if and only if they have descended vertically from the same single parental gene in their last common ancestor. The last component is exceedingly important because all opsins -- indeed all GPCR -- are ultimately descended from a single gene. However that single gene was not to be found in the common ancester of cnidarian and bilaterans because sponges already appear to have classical opsins and perhaps hundreds of GPCR.
Most ancestral introns in human genes were established in unicellular eukaryotes well prior to fungal and green plant divergence. For example the distinct introns in close paralogs SUMF1 and SUMF2 were in place before human/diatom separation. It's very difficult to imagine how the introns in neuropsins, rgropsins, peropsins, melanopsins, encephalopsins, pteropsins, and ciliary opsins could have descended from a single gene in Eumetazoa.
Evolution of photoreception: the eyeless anthozoan Nematostella vectensis as a model Poster talk March 22-23, 2007 Heather Q. Marlow, Daniel I. Speiser, David Q. Matus and Mark Q. Martindale (Email: marlow@hawaii.edu) "Eyes have evolved numerous times within the animals, yet there has been surprising convergence in the morphology, function and molecular basis of development in these structures. Although these diverse eye types have arisen independently, many taxa utilize similar cassettes of genes to specify them. These de- velopmental genes include members of the SIX class of homeodomain proteins (sine oculis and optix), eyes absent, dachshund and famously, the Pax genes (Pax6). Additionally, all animals in which photoreception has been investigated use the opsin family, a class of seven transmembrane receptors, to detect light. Cnidarians are an early branching lineage that are likely to have diverged from the rest of the animals before the evolu- tion of discrete eye structures. The ancestral cnidarian did not posses eyes, however like the extant anthozoan cnidarians (sea anemones, corals, and sea pens), it was likely to have had photoreceptive cells. In order to determine the level at which cnidarian photoreceptive cells may share homology with bilaterian eyes, we have examined the expression of these “eye” genes during development in the anthozoan cnidarian model Nematostella vectensis through in situ hybridization. We have also identified, cloned, and studied the expression of many members of the visual opsin class of receptors in N. vectensis. Our data indicate that N. vectensis possesses putative photoreceptive cells which express several orthologs to the visual opsins, that the organization of photoreceptor cells differs between different life history stages of the animal, and that presumptive photoreceptor cells express many of the same developmental molecules that specify eye development in bilaterian animals. These findings support the hypothesis that eyes may share homology only at the level of the photoreceptor, and that additional “eye” genes may have been co-opted into the eye specification pathway from more general neural roles in bilaterians."
A fourth group published a 19 Dec 07 paper on putative anthozoan and hydrozoan opsins, releasing 54 full length sequences to GenBank. These include 31 full length intronated predicted genes for Nematostella, 21 mRNA for lens-eyed Cladonema radiatum, and 2 for eyeless Podocoryne carnea. The latter two species are hydrozoa without genome projects meaning the transcripts cannot be intronated. Many of the 54 proteins have best-blastp below 30% identity within the 230 validated opsins of the phylogenetically comprehensive reference collection. This is worse than some generic non-opsin GPCR, so almost all of the residue matching will be non-specifically exhausted. All have lysine in homologous position, so potentially covalently bound retinal (though that was not established chemically). The counterion situation does not work out at either E113 or E181. Five are missing the universally conserved early asparagine and two others are truncated.
Conserved residues in putative cnidarian opsins relative to bovine rhodopsin and consensus sequences for ciliary, melanopsins, pteropsins, peropsins, and all validated opsins.
..........................................................*...................................................................*..................................................................................................................*..................
rho1 NFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFR
cili N.lv...t.k.k..LrPlN.ilvNla.a#l.....g..........gyfG.....C..eG%...l.G.v.lwsl.vla.dRy.v!ckp.g..f.a.g.........f.....W..pPl.GWs.Y.peg...sC...w.....s%..f.c...........Pl.i....Y..l.........aE..v.rM!..M!..%l...........cW.PYaa........p..P...........faKss.%NPi.IY.f$Nk#fr
cnid N..vi..................s.a..d..........................C...gf........si.hl.....ery........................W.....w...Pl.GW..y..e.....C...w.....sY............l..%P.................m....i..%......................aWtPYa..............l.........fAK.s..nP...%......fr
vali N..V.......k..LRP.N...vNLA..Dl...................g.....C..yg%.....G..s...$..ia.dRY.v!..P......a...........W.....w...Pl.GW..Y.pEg..tsC..#w.....s%.............f.%Pl!I.%..Y..i..........E.....m...m!..F.............W.PYa.........p..P...........fAK.s.%NP!.IY......%R
mela N.lv...f...ksLrtp.N.fIiNLA.sDf.ms....P....s.....W.fG...C.lYaF.g.lfG..S..t$..Ia.DRY.v!t.Pl..s.r.i.v........W.ysl.Ws.pP.fGwg.YvpEG..tsCt.D%.t..r.%.$.f.FPl.i..cY..if.a!r....#.k.ak.........%.......................sW.PYa.!.lG..ltpy.P............AKSai.NPi.iYa..hpkfR
pter Ng.V!.!F..tKsLRTPsN$lV!NLA.sDf.MM..m.Ppm.nc%.t..w.lG...C#.Ya..Gsl.Gc.siwtm..Ia.DRYnvIvkg.p$t..Ali.........W.....W...P.fgwnRYVPEGn$TaCgtDYLt.srs%.ys.vYP$.I!%.Y.fIv.aV.aHEkE.rlAK.vAl.t.sLwf......................aWTPY..!n.G...tPl.ti............k.a...p..vy.ishp.yr
pero N..v...f.k........#....nLA..D.g!s..g.p....S.....W.%G.G.Cq.ygf.gf.fg..Si...t.!a.DRY..iC......$.............W...afWa..Pl.Gwg.YEP.g..t.Ctl#w......%...............%P.!m....Y..!..K.k.....tk............%l...........aW.PYa!..w..f..p.ip.$..........AKs...NP..!Y...#..fr
rho1.NFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFR
Hydrozoa: Hydra magnipapillata (hydra) .. 0 opsins
Because opsin photoreception is quite ancient, clearly pre-Bilaterans have a major role to play in illuminating the origins of photoreception systems. What's not so clear is that the two cnidarians chosen so far for genome projects are optimal in this regard.
Hydra does not have overt photoreceptive structures or cells obviously specialized for light detection yet it exhibits marked behavioral photosensitivity (noted by Trembley in 1744). Studies beginning in 2000 flagged the ectoderm (using antibodies to squid rhodopsin), known to contain epidermal sensory neurons, as responsible for extraocular photoreception. Musio and coworkers sought to recover opsins using degenerate primers, targeting melanopsin as the most plausible in Hydra because that opsin seems not to require advanced relationships with neighboring cells (ie, acts as photosensor and its own photoisomerase) but no opsin sequences have been submitted to date to GenBank.
The Hydra cdna CB073527 was proposed as a peropsin based on best-blast to mouse peropsin. However using a much larger collection of demonstrably orthologous chordate peropsins in the Opsin Classifier conflicts with this interpretation: the putative cnidarian gene needs to consistently associate with this gene family (equivalently, have best match to it among all reconstructed ancestral opsins) but does not. Furthermore the best match is very weak at 31%. These are exactly the signatures of generic non-opsin rhodopsin superfamily members (which we expect any eumetazoan to have by the hundreds).
With the imminent availability of the Hydra genome assembly (or just using the trace archive), the 161 amino acids of the fragmentary transcript can be extended for example with trace 1121878952 to apparent full length (309 aa) and its introns determined (none). This does not improve its best-blast score nor family coherence. It does not cluster consistently with ciliary opsins -- what would the signaling partner be when the matches are scattered between Gt, Go, and Gq opsins? The blast probability of 1.6e-34 does not mean much under these circumstances.
Two putative hydra opsin fragments can be extracted from Fig.1 of an Oct 2007 paper, AKSSTIINPTISCIIYKE and AKLSAVLNALVNCYINKS. These too fail to extend to fully convincing opsins. Expression centers around the hydropore. Note though that fits GPCR chemoreceptor localization even better -- there is meagre behaviorial evidence for photoreception near the hydropore and no possibility of an imaging eye. No ultrastructure study was conducted -- that is needed to demonstrate that the putative opsin is expressed in specialized photoreceptor cells. No non-opsin controls were included in the alignment -- all GPCR proteins bind heteromeric G proteins and many have lysine without binding of retinal. The cdna accession numbers are Hydra1 CN554949 and Hydra2 CV15164.
These papers highlight the special difficulties in working with cnidarian opsin candidates. We know from the outset that they will be quite diverged. Multiple forms of supporting data are needed, preferably in the form of diagnostic introns, alignments demonstrating conservation of critical residues and structures, in situ hybridization to anatomically plausible neuronal photoreceptors, and specific loss of photobehavior upon knockdown.
A higher standard of proof is needed for the first cnidarian opsins because validated ones will surely be used to pull in further homologs via annotation transfer. There is a definite risk in admitting inadequately documented opsins to the Opsin Classifier because once that database is tainted, it could draw in even more non-opsins from the GPCR world.
CnidBase provides a blast service to cnidarians including hydra but this appears restricted to ESTs and so only duplicates GenBank. GenBank does not carry any contigs or genome assembly on 12 Dec 07. Some 10.2 million Hydra traces have been provided by JCVI, ample for the 1290 Mbp estimated genome size. However the hydra genome project is no longer mentioned on that website. The draft genome expected in Dec 2005 has not surfaced, possibly because high AT content complicated assembly.
Because trace archive searches require a good query, the best current opsin search strategy uses tblastn of the excellent EST collection and extends those results with good Opsin Classifier outcomes with trace reads. Using that method, I recovered an intronless melanopsin candidate could be further characterized bioinformatically but in the absence of experimental support cannot be proven definitively involved in hydra photoreception.
>MEL?_hydMag Hydra magnipapillata CV465424 MAGNDTLEKFSKEIIIIKSLYLVICIILGLIGNLVVLITILKYRKLQTITNYFVLNLSITDLLFIICCMPTIIITTIGEKWLLGNAVCNIIGFLNVLLCTNSIWNLVMISINRYLNVAKPKKIKEIYTRKKTILMI ISVWIVSGLVSVPPLLNWSSYKPGPNFCTVDRKGAKSFYLLILLIMYILPLLILVSLYSCIFFILKKKGKKILLKCNINYIEHSDCKGNASIYKNGLLSYQAG NKQISNKKIMINYFITKNNDTYKVSVKKAQNHNKKLQKCVKLYKQYQITKRLMVLVLSFF LFWTPFFIGSFLITYGVKNKKNFHFTTFGVMCGCLSSISNPFIYSMNSSFRNHLRKLSRNFFNEKNY* >Per?_hydMag magnipapillata Hydra cdna CB073527 MAFVFIIVFLSFLCGFSVILNVTVVLTILAKGNTKNTRDVILMSLAICDGVQCTIGY PVELFGYANYKNPSLSEKFCKPSGFIVMYLALTAIAHLVCLCIYRYLTIVYPLKLQIFLT KSNWSACGCIAFCWIYGLFWSLSPLLGWNEIVRENKDTYKCSINLYPDNEIKSSYLYALA IFCYLIPLIIIIYCSLKVHSELRNMLKMCKQISGVEANITKVTYRIEKQDFISVSFIIAS FFTVWTPYAVCVFYLTIGKKLPPSFLTYCALFAKSSTILNPIIYCLMYKKFRQTLQSKFG KLFNNPTVTPAV* 0
Hydrozoa: Cladonema radiatum (jellyfish) .. 0 opsins
A Dec 2007 paper reports 20 mRNA opsin candidates for the lens-eyed hydrozoan jellyfish, Cladonema radiatum. These generally classify as ciliary opsins and the ones tested are expressed somewhat appropriately. However even the best alignment to validated opsins is very weak, no better in percent identity than many non-opsin GPCR (here 13 were used as outgroup without rationalization). However back-blastp to GenBank nr shows no non-opsin GPCR among the best matches.
The authors did not establish the existence of retinal in this species nor show 11-cis retinal covalently bound to any candidate. They note Schiff base lysine occurs in correct homologous position but do not comment on the absence of counterion at traditional positions 113 or 181 (bovine RHO1 numbering). That lysine is necessary for an opsin but not sufficient (it might arise here from primer bias). Non-opsins such as GPCR176 can have lysine at this position as well, making it only semi-diagnostic:
CropN1 KFSVVSNPIVYVIFYKDFR
K S+++NP++++ K R
GPCR176 KVSLLANPVLFLTVNKSVR NP_009154
CropN1 KFSVVSNPIVYVIFYKDFR
K + + NP++YV + FR
LWS_homSap KSATIYNPVIYVFMNRQFR
The number of 'opsins' is excessive given numbers of validated opsins that occur in complete bilatera genomes, even allowing for eyespot developmental stage variations and auxillary functions such as gonad photoreceptive gamete release. Recent gene family expansions might make more sense for chemosensory or chemokine recepters than opsins.
In this view, 1-2 bona fide opsins might lurk among the collection -- but which ones?. Opsins evidently experienced various gene duplications which appear subsequently co-opted to (unknown) non-opsin, non-photoreceptive roles. This causes them to nest confusingly within the opsins even though they are no longer photoreceptors. There may have been selection to maintain the buried lysine because it worked structurally at the time of duplication (offset perhaps by chloride ion) or is used for a new but chemically related signalling agonist. The same phenomonon (gene duplication and neofunctionalization) may have occured within Nematostella and Daphnia, which both have 'too many' opsins for their imaging needs. The Daphnia non-opsin opsin gene familiy expansion is not even broadly shared within the Crustacean clade.
The confusion really arises from the notion of "terminally diverged" opsins first studied within Bilatera. That is, within deuterostomes, we observe a sequence of gene duplication and divergence say encephalopsin --> pinopsin --> LWS --> other cone opsins but that stays within opsins. Even that sequence had largely terminated 500 million years ago at time of lamprey divergence (primate color vision recovery is an exception). An analogous sequence is familiar within Arthropoda for example melanopsin --> MWS --> UVS. We don't observe the sequence encephalopsin --> pinopsin --> LWS --> bradykinin receptor in human nor melanopsin --> MWS --> glycoprotein hormone receptor in drosophila. Nor do we expect any such 500 million years in the future.
In Bilatera, it seems once an opsin, always an opsin. Gene duplication still occurs but opsins are apparently so deeply dug into their hole of specialization of function and tissue expression that a gene duplicate cannot be retained unless it can carve out a niche for itself as limited variant of photoreceptor opsin, say new color sensitivity or polarization detector. Lens crystalins prove that genes often have pre-existing multiple disjoint functions (glycolytic enzyme, refractive index supplier) and so at duplication the niche is already there, merely awaiting partitioning of expression after which sequences can optimize to their respective niches or just drift. Opsins in contrast are single-purpose.
Opsins may not have been so committed in early diverging ancestral cnidaria with less elaborated photoreceptive systems and metazoan cell type specializations. Not so terminally diverged, opsin gene duplicates may have retained overall GPCR signaling capacity but for some other agonist than cis-retinal. After all, shifts in outside molecular trigger happened frequently in generic GPCR evolution, accounting for their vast diversity of functionality despite minimal departures from the universal hepta-transmembrane structure. Ready shifts in agonist are not a design flaw but rather a design feature. Variation in agonist may be tolerated, especially in ancestral GPCR, and GPCR gene duplication and divergence coupled to that of a peptide agonist.
Opsins seem unique in that cis-retinal is covalently attached, whereas other GPCR agonists diffuse in transiently to their binding site. This makes it difficult to see what the 'next' agonist could be in a duplicated non-opsin opsin (other than something very similar like vitamin A variants seen in some teleosts). However it's been argued that the photoisomerization product, trans-retinal, is really the agonist. That's non-covalently bound similarly to other GPCR effectors.
If so, that would make agonist shift in a duplicated ancestral metazoan opsin no different from other shifts taking place in other duplicated GPCR. Indeed, opsins arose from other GPCR; the ur-GPCR was not necessarily a retinal binder. Still, we wonder what the new agonists could be in this cloud of cnidarion opsin-like proteins and what signalling is accomplished where. Hybridization in Cladodema suggests the site of signalling has not moved appreciably.
It's worth re-examing the notion of "once an opsin, always an opsin" even in Bilateran history. First we wonder about the cloud of lineage-specific opsin-like duplications in the crustacean genome of Daphnia. Using bovine RHO1 as query against human genome turns up a dozen non-opsin GPCR exhibiting better matches than the bona fide opsin RGR. Very likely these would nest within opsins with respect to RGR. This suggests that certain non-opsins occur inside the broader photo-opsin family. However here it is not so certain that RGR is a degenerate photoreceptor opsin, today 'merely' a retinal photoisomerase in boreoeuthere placentals retaining the Schiff base lysine but not covalently binding cis-retinal. A similar question arises with neuropsin and peropsin.
RHO1_bosTau KTSAVYNPVIYIMMNQKFR query NP_001044 somatostatin receptor 5 [Homo sapiens] 1e-26 NSCA--NPVLYGFLSDNFR non-opsin GPCR NP_001048 tachykinin receptor 2 [Homo sapiens] 2e-25 MSSTMYNPIIYCCLNDRFR non-opsin GPCR NP_000900 neuropeptide Y receptor Y1 [Homo sapiens] 1e-23 MISTCVNPIFYGFLNKNFQ non-opsin GPCR NP_000721 cholecystokinin A receptor [Homo sapiens] 1e-23 YTSSCVNPIIYCFMNKRFR non-opsin GPCR NP_000903 opioid receptor, mu 1 isoform MOR-1 [Homo sapie 3e-22 YTNSCLNPVLYAFLDENFK non-opsin GPCR NP_004212 G protein-coupled receptor 50 [Homo sapiens] 1e-21 YFNSCLNAVIYGLLNENFR non-opsin GPCR NP_006047 neuromedin U receptor 1 [Homo sapiens] 1e-20 LGSAA-NPVLYSLMSSRFR non-opsin GPCR NP_001471 galanin receptor 1 [Homo sapiens] 1e-20 YSNSSVNPIIYAFLSENFR non-opsin GPCR NP_005949 melatonin receptor 1A [Homo sapiens] 1e-20 YFNSCLNAIIYGLLNQNFR non-opsin GPCR NP_000614 bradykinin receptor B2 [Homo sapiens] 4e-19 YSNSCLNPLVYVIVGKRFR non-opsin GPCR NP_002912 retinal G-protein coupled receptor RGR_homsap 4e-18 KMVPTINAINYALGNEMVC opsin RGR_homsap NP_003292 thyrotropin-releasing hormone receptor [Homo 3e-18 YLNSAINPVIYNLMSQKFR non-opsin GPCR NP_005152 angiotensin II receptor-like 1 [Homo sapiens] 7e-18 YVNSCLNPFLYAFFDPRFR non-opsin GPCR NP_000901 neuropeptide Y receptor Y2 [Homo sapiens] 9e-18 MCSTFANPLLYGWMNSNYR non-opsin GPCR NP_000570 chemokine (C-C motif) receptor 5 [Homo sapie 2e-17 MTHCCINPIIYAFVGEKFR non-opsin GPCR NP_000670 alpha-1B-adrenergic receptor [Homo sapiens] 3e-16 YFNSCLNPIIYPCSSKEFK non-opsin GPCR
No genome project is planned so the mRNA cannot be examined for diagnostic intronation; this could be done indirectly if candidates help locate orthologs in other cnidaria. However they are already very diverged from Nematostella and Hydra opsins. Introns would not be informative anyway in discriminating opsins from co-opted non-opsin, non-photoreceptors arising as segmental duplications. Indels would be similar. This presents a very difficult bioinformatic problem because truly diagnostic residues of functioning opsins could be quite subtle.
Similarly on the experimental side, antibodies would likely cross-react. The derived non-opsins likely still signal with a transducin-type G-protein and are quenched by the same arrestin, so no help there. Knockdowns might have unforseen consequences in these non-opsins, indirectly disrupting photosensitive behaviors. Thus the best way forward in identifying the true opsins within the collection is probably in vitro expression, reconstitution with cis-retinal, and demonstration of photoisomerization.
Placozoa: Trichoplax adhaerens .. 0 opsins
The sequenced genome of Trichoplax adhaerens appears in the 21 August 08 Nature and associated [98 pages of supplemental], an excellent treatment as genome articles go but still insufficient detail to replicate various bioinformatic assertions. The genome and browser are hosted at JGI but it is equally convenient for most purposes to simply use NCBI tblastn targeted to the WGS contig division restricted to Trichoplax.
The authors identify 4 genes as photoreceptive opsins, based on GPCR blast character, lysine in expected position, and unpublished accounts of phototactic behavior. However notation used in the document (scaffold8_1356180_1396180 = Opsin 6, scaffold13_1543556_1583556 = Opsin 26, scaffold8_1308974_1348974 = Opsin 30. scaffold8_1467859_1507859 = Opsin 31) does not match that provided at GenBank nor JGI genome. Gaps in assembly are indicated by N's which may or may not be counted in coordinate numbers. Opsins with these scaffold numberings do not surface by tBlastn of GenBank WGS where the Trichoplax contigs reside. The authors have not responded to an email request to furnish the fasta sequences.
In light of similar claims made for Hydra, Cladonema and Nematostella opsins that didn't bear up to scrutiny, given the lack of photoreceptor structures and cell-specific expression staining in Trichoplax, the burden of proof for opsins has not yet been met. Nothing in the Trichoplax genome meets the best-blastp threshold (exceeding the 25-35 percent identity range of generic GPCR matches) of the opsin classifier. Bona fide opsins also require a counterion E at ancestral position, a DRY motif, a binding motif for alpha subunit of heteromeric G protein, and about 150 semi-invariant residues that distinguish photoreceptors by ortholog class (eg ciliary vs rhabdomeric) and separate them from non-photoreceptive 'EK-rhodopsin-class' generic GPCR.
The only validated pre-Bilateran opsin to date occurs in the imaging eye of the cubozoa Tripedalia cystophora where a single ciliary opsin sequence meets all expression and classification tests. This opsin has no noteworthy matches in Trichoplax. Cnidarian larva also have a rhabdomeric structure implying that class of opsin as well.
Examples exist of non-opsin non-photoreceptive GPCR that contain lysine at the retinal position, ie this lysine is necessary for an opsin but far from sufficient. They are easy to collect using blast of consensus opsin sequence ending somewhat past that lysine. Cnidaria are especially rich in these lysine-containing non-photoreceptors. Indeed the 'opsins' reported for Hydra, Cladonema and Nematostella greatly excede the (non-observed) photoreceptive structures and organismal needs -- which surely aren't twice those of the most advanced bilatera.
Photoreceptive opsins did not originate out of thin air by miraculous multiple mutations providing overnight EK, signature motifs and retinal binding pocket. More plausibly, opsins specialized from a pre-existing gene expansion pool of EK-class GPCR. That class persists today in pre-bilaterans with unknown agonists and unknown function though that class has largely have disappeared in protostomes and deuterostomes. It would come as no surprise if genuine opsins nest paraphyletically (ie were recruited by independent events) within EK-rhodopsin class GPCR.
The unpublished observation of phototaxis in Trichoplax is only weak supportive evidence for opsins because demosponge larva also exhibit phototaxis (shadow seeking under coral rubble) whereas the action spectrum fits a flavin or carotenoid chromophore better than retinal. Larval photoreceptors don't reside in a rhabdomeric or ciliary morphological setting but rather in ring of columnar monociliated epithelial cells. No expression staining has been conducted for the putative opsins -- Trichoplax has only 4 cell types, none specialized in appearance to photoreceptor.
Cryptochromes are another well-known alternate photoreceptive system in bilatera with no homology at the protein level to opsins. In all kingdoms of life, only seven known families of proteins transduce light into signals (opsins, cryptochromes, phytochromes, xanthopsins, phototropins, BLUF, and LITE); Trichoplax would have to be evaluated for each of these too. For example, nematode C. elegans lacks opsins and cryptochromes but has a shorter wavelength photoresponse bypassing cAMP and diacylglycerol (DAG) downstream signalling that neurons commonly use to control behavior. The primary photoreceptor LITE1 (NP_509043) is a 8-transmembrane member of the invertebrate gustatory receptor family (non-GPCR).
Trichoplax could have an unobserved larva and metamorphosis in view of the proposed post-sponge position. Alternatively, it may have be a direct developer or have lost the ability to reproduce other than by fission (which is contradicted by meiosis genes, oocytes and population genetics despite non-observation of male gametes). Trichoplax has never been observed directly in the wild -- instead it is collected on submerged alga-coated microscope slides (or aquarium walls). Whole aspects of its life cycle may go undetected in labratory culture. The current situation -- highly conserved genome, highly derived morphology, post-sponge divergence -- is an odd mix.
Even if this phylum lacks opsins, the genome will still prove important in determining the state of signaling systems. The 98 mbp genome is 3% the size of a mammalian genome but the estimated 11,514 coding genes are not that different from Drosophila and 55% of the 20,000 genes of human (and thus inconsistent with subsequent 2R or 45,056 genes without massive gain in Trichoplax and/or loss in human). In other words, even if 2R occured, it was an inconsequential mechanism in the overall scheme of gene duplication and retention. That has special relevence to understanding expansion and specialization of opsins and associated G protein alpha subunits.
Trichoplax is an odd amoeboid-shaped animal without overt symmetry, body plan, recognizable organs, or internal digestive gut but clear dorsal/ventral sides. Only a single species has received a Linnean name to date; it is assigned a whole phylum, Placozoa. However the taxonomy section of GenBank lists 87 other placozoan isolates; these have ~200 deposited sequences and previous publications have established quite diverged mitochondrial genes, compatible with a whole order (even as external morphologies remain indistinguishable). Thus the 600 myr long branch of the Red Sea isolate could readily subdivided by 454 sequencing to provide supplementing glimpses of ancestral characters and better reconstruction of ancestral proteins.
The authors place the divergence node between sponge and cnidaria, surprising given the advanced sponge larva and its similarity to later-diverging metazoan. Post-sponge divergence (but sistered with Cnidaria) was proposed earlier in a 1993 Science article based on small subunit ribosomal RNA sequences. The place of Ctenophores still cannot be resolved for lack of an available genome, though just about every topology has received support. Thus the number of early metazoan nodes discussed in "The Ancestor's Tale" is still uncertain.
In a 1996 PNAS article, four of the same authors made an equally convincing argument for Trichoplax basal to sponge using both mitochondrial protein analysis and odd ancestral features such as retained introns and 5 retained ORFs exceeding 100aa:
"Our analysis shows that the Trichoplax mitochondrion possesses the largest known metazoan mtDNA genome, at 43,079 bp, more than twice the size of the typical metazoan mtDNA. Its large size is due not to secondary expansion but to features shared with metazoan outgroups, such as intragenic spacers, several introns [cox1 introns share identical positions with choanoflagellate Monosiga and fungus], ORFs of unknown function, and protein-coding regions that are generally larger than that found in animals. The large Trichoplax mtDNA is the least derived mitochondrial genome of any animal. Moreover, the Trichoplax mitochondrion shares unique derived features with other lower metazoans, notably the loss of all ribosomal protein genes. These structural features of the Trichoplax mitochondrial genome, along with Bayesian and maximum-likelihood (ML) analyses of mitochondrial proteins from metazoans and outgroups, provide robust support for the phylogenetic placement of the phylum Placozoa at the root of the Metazoa.... the basal phylogenetic position of Placozoa within the lower metazoans is robust, with P values between 0.924 and 1.000 for the various statistical tests."
It appears that an unpublished, unreleased assembly of proteins of the sponge Amphimedon was used (yet again). This genome project is 100% publicly funded yet its assembly seem to have been privatized to a shortlisted clique of insiders. Citation-free Lottia gene models also see use. Both are analyzed by unpublished SNAP ab initio predictions (Table S7.1). This raises some questions because neither reviewers nor other scientists can independently evaluate the evidence supporting the unexpected phylogenetic relationships. It is reminiscent of the recent uproar over non-release of dinosaur collagen mass spectroscopy.
The JGI site shows sponge still in draft assembly on 25 Aug 08 whereas this paper was submitted nine months earlier, on 4 Dec 07. Trace reads were completed and made available in June 2005 but these cannot be used for genes or proteins without assembly as individual read typically cover but single exons. Assembly and first publication is normally reserved for the sequencing laboratory but here it seems to be completed but held back for years.
Trichoplax appears to retain a goodly share of ancestral characters, including some chromosomal gene associations and a large number of apparent 1:1 orthologs to human and anemone. However it must be noted that the authors have significantly altered the traditional definition of synteny in making their dot plot (Oxford grid) by discarding strand orientation altogether, allowing weak partial length blastp hits (perhaps just to common domains or pseudogenes) to count as orthologous matches, and accepting departures of 10 genes from adjacency (which can amount to several million bp in mammalian genomes).
The assumption here is small and very localized intra-chromosomal inversions have been more frequent than inter-chromosomal arrangments over the vast 1.2 billion year roundtrip span of evolutionary time (but see gibbon, fly, tunicate etc). As described a decade ago, dot plots rendered in Photoshop can better retain orientation and quality of fit using grayscale and tint, rather than be all-or-none as here.
The 11,514 coding gene models arise largely from an informatics pipeline tool fGenesh. Like all gene predictors, even when parameterized with transcripts, this tool makes numerous errors in human (where it can be thoroughly evaluated by comparative genomics) and is no longer included in the 35 predictive gene tracks at UCSC (though still valued for nematode and other species). The tool acted after RepeatMasker masking of 665 transposons; if that library were incomplete on low copy elements, the gene count could be too high.
Manual curation is mentioned briefly but could not have been extensive given the number of genes. Gene models missing start or stop codons were simply extended out from available sequence (though in some cases transcript extension was feasible). While a downstream stop codon can always be found, an initial methionine candidate does not always occur before an upstream stop codon is encountered. This is not a good annotation practise as it assumes that partial first and last exons are at hand; better to do this only when accurate gene models from other species warrant these two assumptions. These extensions will seldom have homological support even when correct unless the termini are important (eg signal peptides; G protein C-terminal opsin interaction).
Only 58 ESTs are provided by GenBank (from an unpublished immunology study by different authors); in the nucleotide division, it appears that GenBank does not distinguish experimental mRNAs from those simply inferred from genome models. Transcripts have proven very helpful in quantitating gene prediction accuracy. In assessing completeness of the genome, the authors state 85% of 14,571 T. adhaerens ESTs (later described as 2,506 when clustered of 21% coverage) have quality matches (a more nuanced account appears in Supplemental). If 15% did not make the cut -- assuming them to be representative of missing or partial genes or absent from transcripts -- that would bring the total coding gene count to 13,241.
These 2,506 assembled transcripts could be downloaded at the indicated JGI url and tested to see how and if they are stored at GenBank as this affects the average user. The article does not discuss how discrepancies between transcripts and pipeline gene models were resolved. These can involve spliced-out exons with or without comparative genomics support and non-support of called exon boundaries (here the transcripts will have it right).
On a species so distant and little studied biochemically as Trichoplax (27 articles since 1974, mainly field work or rDNA sequencing), when protein alignment dips below the 40% protein-level identity on partial matches (notably GPCR putative opsins), homological transfer of annotation from functionally characterized proteins won't be reliable beyond rough domain-level concepts. Best-blastp percent identity to known genes is not noted at GenBank model entries.
Here signalP, InterPro, and TMHMM were used to predict signal peptides, domains, and transmembrane peptides; while not validated with pre-bilateran metazoan protein chemistry to any extent, these tools provide a good start if only to localized functional elements. KEGG and KOG are not sufficiently developed to be worthwhile; indeed, development appears abandoned (2004-05 versions were used). EC numbers and GO nonsense add little value. Biosynthetic pathways were not analyzed and so essential amino acids, cofactors, and intermediary metabolism not determined.
What is needed here is an ability to filter or grade annotation transfer quality vis-a-vis match quality, match extent, domain structure, and gene family extent along the lines of GeneSorter at UCSC. For example, Trichoplax/human matches can be very high as in the 77% identity agreement seen in G protein alpha subunits (below) or very low 29% in best matches of some opsins to Trichoplax GPCR.
None of this has to affect opsin analysis (other than missing assembly) because the genome sequence can be directly searched by tblastn without reference to JGI gene models or annotation. Any assertion of opsins must establish the location and phasing of introns in a gene model as these are exceedingly conserved in opsins and diagnostic of orthology classes (and so especially important when protein sequences are so diverged as to blur into generic GPCR).
At this late date, it might not be expected that a metazoan would contain many authentic coding genes with no blast matches in all of GenBank. These may prove greatly enriched for artefacts, just as the Ensembl human gene set used contains nearly 2,000 pseudogenes, related debris and mispredictions not supported by the 28way comparative genomics track to any phylogenetic depth. It's not clear what fraction had supporting transcripts. Dropping these will roughly offset valid genes missing from the assembly or missed by gene prediction.
Similarly, introns will not be located correctly if this is homologically forced in regions of poor identity (self-fulfilling prophecy); phase agreement can help but not so much if based simply on GT-AG which occur every 16 bp approximately, nor even with nuanced splice rules if merely assumed from remotely related species. The practical impact is that exceptions and imperfect matches are missed -- the authors report excellent overall conservation of (high quality flanking) introns with respect to human and Nematostella , which fits the modern picture of intronation being deeply ancestral and profoundly conserved outside a few rogue species (such as fly, nematode, and tunicate) with high turnover. Some 150 known splice sites that use rare alternatives to GT-AG may also be as deeply conserved though this has not yet been investigated.
Manual ab initio curation here at genomeWiki of selected genes of signal transduction (alpha subunits of Trichoplax heteromeric G proteins) shows that cGMP Gt transducin-type alpha subunits (presumably still hyperpolarizing) share the identical 8-exon structure and phasing of human and other bilatera, including the anomalously short 15 residue exon 2 that distinguishes this class of genes from the otherwise identically intronated 7-exon Gq alpha subunits that utilize phospholipase C hydrolysis of PIP2 and IP3 signaling. This strongly suggests that, though the requisite gene duplication and divergence took place much earlier, the distinctive exon 2 emergence (or fusion) predates metazoa. The presence of Gt and Gq subunits does not imply the existence of melanopsin or encephalopsin homologs because these alpha subunits must service hundreds of other unrelated GPCR.
>GNAi1_triAdh Trichoplax adhaerens (placazoa) Gt XM_002115978 77% GNAi1_homSap 8 exons 0 MGCAASAGDKVAAAKSKEIDKKIKSDAEKAAREVKLLLL 1 2 GAGESGKSTIVKQMR 21 IIHESGFSEEDRAQYKPVVFSNTMQSMAAIIRAMGVLRIEFGDKTSLV 0 0 GDARRLFEIMDAPGVQEFTPEIVSLLKRLWSDHGVQQCFSRSREYQLNDSAPY 2 1 YLNSIDRLGKPEYIPSEQDVLRTRVKTTGIVETHFTFKDLHFK 2 1 MFDVGGQRSERKKWIHCFEGVTAIIFCVSLSAYDLVLAEDEEM 0 0 NRMMESMKLFDSICNNKWFTETSIILFLNKKDLFQEKILKSPLTICFPEYT 1 2 GANTYEEASAYIQMKFEDLNKMKDQKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKDCGLF* 0 >GNAQ_triAdh Trichoplax adhaerens (placazoa) Gq XM_002116172 76% GNAQ_homSap 7 exons 0 MACCLSDEAREQRRINREIEKELKKHKRDAKRELKLLLL 1 2 GTGESGKSTFIKQMRIIHGKGYTDNDRAEFTQLVFQNIFTAIQALIKAMETLNITYEHQSN 0 0 RQRVDVVRTVDPETVGSLSKEHVEAIDSIWNDSGVQECYDRRREYQLSDSAKY 2 1 YLTDLHRLAEPNYLPTQQDILRVRAPTTGIIEYDFNLDTVMFR 2 1 MVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQILAEADSQ 0 0 NRMEESKALFKTIITYPWFQNSSIILFLNKKDILEEKVQKSNIADYFPEYD 1 2 GPPRDAQAGREFILKMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQFNLREYNLV* 0
Porifera: Amphimedon queenslandica (sponge) .. 0 opsins
One marine demosponge genome is available. Sponges lie at the base of multicellular animals. They are not noted for eyes. However demosponge larva do exhibit phototaxis (shadow seeking under coral rubble) but the action spectrum is supposedly a better fit to a flavin or carotenoid chromophore. Sponges also can respond to gravity, current, and chemical cues.
The ultrastructural basis for sponge responses to light has been carefully studied from an ultrastructural perspective -- for an animal lacking nerves and cell junctions, the parenchymella larva are quite capable of responding effectively to light and other stimuli. Larval photoreceptors may lie in a posterior ring of columnar monociliated epithelial cells. A pigment cell occurs but the pigment itself has not been chemically characterized -- the issue is whether it is a tyrosine hydroxylase homologously derived melanin.
Negative larval phototaxis there has been attributed to pigment-filled protrusions in a posterior ring of columnar monociliated epithelial cells. This species may prove insufficient to explain the full range of photoresponsive responses in sponge larva such as circadian rhythm and hexactinellid photoreception (notably the role of [stalk spicules).
However Jacobs et al have proposed a far more sweeping view of early evolution of sensory (and other!) organs in sponges (doi:10.1093/icb/icm094 not yet on PubMed). A related view, that of Gehring, proposes that the eye (and other sensory systems) came before the brain, indeed that the nervous system arose later to coordinate a response to all these inputs. There is support for that in simple photoreceptor cells controlling their own cilia. Consequently we should not be too quick to dismiss sponges for lack of neurons.
Evol Dev. 2008 Mar-Apr;10(2):241-57.
In a 2008 article entitled "Six major steps in animal evolution: are we derived sponge larvae?" C. Nielsen writes:
A scenario for the early evolution of the metazoans. The metazoan ancestor "choanoblastaea" was a pelagic sphere consisting of choanocytes. The evolution of multicellularity enabled division of labor between cells and an "advanced choanoblastaea" consisting of choanocytes and nonfeeding cells. Polarity became established, and an adult, sessile stage developed. Choanocytes of the upper side became arranged in a groove with the cilia pumping water along the groove. Cells overarched the groove so that a choanocyte chamber was formed, establishing the body plan of an adult sponge; the pelagic larval stage was retained but became lecithotrophic [yolk-supplied]. The sponges radiated into monophyletic Silicea, Calcarea, and Homoscleromorpha. Homoscleromorph larvae show cell layers resembling true, sealed epithelia.
A homoscleromorph-like larva developed an archenteron, and the sealed epithelium made extracellular digestion possible in this isolated space. This larva became sexually mature, and the adult sponge-stage was abandoned in an extreme progenesis. This eumetazoan ancestor, "gastraea," corresponds to Haeckel's gastraea.
Trichoplax represents this stage, but with the blastopore spread out so that the endoderm has become the underside of the creeping animal. Another lineage developed a nervous system; this "neurogastraea" is the ancestor of the Neuralia. Cnidarians have retained this organization, whereas the Triploblastica (Ctenophora+Bilateria), have developed the mesoderm. The bilaterians developed bilaterality in a primitive form in the Acoelomorpha and in an advanced form with tubular gut and long Hox cluster in the Eubilateria (Protostomia+Deuterostomia).... The evolution of the eumetazoan ancestor from a progenetic homoscleromorph larva implies that we, as well as all the other eumetazoans, are derived sponge larvae.
The resulting picture of Reneira larva -- numerous differentiated and pluripotential cell types arranged in stereotypic patterns along central-lateral and anterior-posterior axes -- is not one typically conjured up of parazoan ("almost metazoan") in the view of Leys and Degnan. Indeed the common ancestor humans shared with sponge may have been rather advanced.
The concept here is that a photoreceptor cell can control its associated cilium without the baggage of a CNS, either as a passive rudder or more actively directing phototactic motion. In effect the single photocell is a self-sufficient brain that processes external environmental inputs, asseses them and acts appropriately. Chemoreception, a very similar GPCR signaling system, might work the same way. In this view, the nervous system evolvee as a secondary system to coordinate these stand-alone sensory effectors.
The genome of Amphimedon queenslandica has been available since June 2005 at the Trace Archives but never assembled. Consequently tblastn of contigs is not available without do-it-yourself assembly of the 2.9 million traces, a inefficient but increasingly utilized option. The species was formerly called Reniera spp. and it is still carried under that name at JGI Genome. It's also been placed in Haliclona and Adocia. Voucher specimens, here QM G315611, are needed to have everyone on the same genomics page.
A futile search for sponge opsins turned up only non-opsin, rhodopsin-class GPCR genes from Amphimedon. That needs to be revisited with tblastn after assembly with melanopsins and encephalopsins recontructed back to the eumetazoan common ancestor. Similarly, no opsins were located in even earlier diverging placozoan Trichoplax, choanoflagellate Monosiga, and fungal genomes. This fits a picture of photoreceptor opsins first appearing subsequent to sponge in eumetazoa cnidarians. However these were hardly de novo genetic innovations but rather evolved out of the already-rich cauldron of GPCR gene copies in the sponge ancester.
Some later diverging species such as the model organism C. elegans lost all of their opsin genes, making them useless in Urbilateran ancestor reconstruction. This argues for much more intensive genomic sampling of sponges and cnidarians so as to sidestep inference mislead by gene loss in model organisms chosen for historic reasons.
Choanoflagellates .. 0 opsins
To appear shortly.









