User contributions for Tomemerald

26 October 2010

• 22:4722:47, 26 October 2010 diff hist +118‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 15:2615:26, 26 October 2010 diff hist +312‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 15:1515:15, 26 October 2010 diff hist +20‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 reference sequences
• 15:0615:06, 26 October 2010 diff hist 0‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Intron evolution
• 15:0315:03, 26 October 2010 diff hist 0‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Intron evolution
• 15:0215:02, 26 October 2010 diff hist 0‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Intron evolution
• 15:0015:00, 26 October 2010 diff hist +320‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Intron evolution
• 14:3714:37, 26 October 2010 diff hist +601‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Intron evolution
• 14:2614:26, 26 October 2010 diff hist +2,766‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD1 reference sequences
• 14:0414:04, 26 October 2010 diff hist +38‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 reference sequences
• 13:5313:53, 26 October 2010 diff hist +1‎ m Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD1 reference sequences
• 13:5313:53, 26 October 2010 diff hist +1,786‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD1 reference sequences
• 13:4513:45, 26 October 2010 diff hist +6‎ m Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 13:4413:44, 26 October 2010 diff hist +11‎ m Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 13:4213:42, 26 October 2010 diff hist +550‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 13:2013:20, 26 October 2010 diff hist +692‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 13:0613:06, 26 October 2010 diff hist +513‎ Phospholipases PLBD1 and PLBD2 ‎ →‎Conservation at critical sites
• 12:5212:52, 26 October 2010 diff hist +2,379‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 12:0212:02, 26 October 2010 diff hist +52‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 12:0112:01, 26 October 2010 diff hist 0‎ N File:PLDB1consSites.png ‎No edit summary current

25 October 2010

• 16:5616:56, 25 October 2010 diff hist +69‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 16:5416:54, 25 October 2010 diff hist 0‎ File:PLDB2consSites.png ‎ uploaded a new version of "Image:PLDB2consSites.png" current
• 16:4516:45, 25 October 2010 diff hist 0‎ N File:PLDB2consSites.png ‎No edit summary
• 16:0216:02, 25 October 2010 diff hist +33‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 16:0016:00, 25 October 2010 diff hist 0‎ N File:PLBD1colored.png ‎No edit summary current
• 15:5115:51, 25 October 2010 diff hist +628‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 15:1515:15, 25 October 2010 diff hist +46‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 15:1315:13, 25 October 2010 diff hist +15‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 15:0815:08, 25 October 2010 diff hist 0‎ N File:PLBD2colored.png ‎No edit summary current
• 15:0615:06, 25 October 2010 diff hist +1‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 14:5114:51, 25 October 2010 diff hist +514‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 14:0314:03, 25 October 2010 diff hist +295‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 active site
• 13:4113:41, 25 October 2010 diff hist +515‎ Phospholipases PLBD1 and PLBD2 ‎No edit summary
• 13:1113:11, 25 October 2010 diff hist 0‎ N File:PLBD2activeSiteComp.png ‎No edit summary current
• 13:0913:09, 25 October 2010 diff hist +1‎ m Phospholipases PLBD1 and PLBD2 ‎No edit summary
• 13:0813:08, 25 October 2010 diff hist +624‎ Phospholipases PLBD1 and PLBD2 ‎ →‎PLBD2 reference sequences
• 13:0013:00, 25 October 2010 diff hist +46‎ m Phospholipases PLBD1 and PLBD2 ‎No edit summary
• 12:5712:57, 25 October 2010 diff hist +5,719‎ N Phospholipases PLBD1 and PLBD2 ‎ New page: === PLBD1 reference sequences === >PLBD1_homSap Homo sapiens (human) FLJ22662 PMID: 19019078,20093120 0 MTRGGPGGRPGLPQPPPLLLLLLLLPLLLVTAEPPKPA 1 2 GVYYATAYWMPAEKTVQVKNVMDKNGDAYGFYNNSVKT...

23 October 2010

• 18:0918:09, 23 October 2010 diff hist +117‎ m Sulfatase evolution: ARSK ‎ →‎ARSK, IDS, and choline sulfatase reference sequences
• 18:0618:06, 23 October 2010 diff hist +3‎ m Sulfatase evolution: ARSK ‎ →‎ARSK, IDS, and choline sulfatase reference sequences

22 October 2010

• 13:4513:45, 22 October 2010 diff hist +7‎ m Opsin evolution: key critters (cnidaria) ‎ →‎Ctenophora: Pleurobrachia pileus (sea gooseberry) .. 2 opsins
• 13:4213:42, 22 October 2010 diff hist −4‎ m Opsin evolution: key critters (cnidaria) ‎ →‎Ctenophora: Pleurobrachia pileus (sea gooseberry) .. 2 opsins

7 October 2010

• 11:2011:20, 7 October 2010 diff hist +53‎ Opsin evolution: Neuropsin phyloSNPs ‎ →‎Neuropsin backgrounder current
• 11:1311:13, 7 October 2010 diff hist +81‎ Opsin evolution: Neuropsin phyloSNPs ‎ →‎Neuropsin backgrounder
• 10:3710:37, 7 October 2010 diff hist −175‎ Opsin evolution: Neuropsin phyloSNPs ‎ →‎Neuropsin backgrounder
• 10:2310:23, 7 October 2010 diff hist +1,119‎ Opsin evolution: Neuropsin phyloSNPs ‎No edit summary

6 October 2010

• 21:1121:11, 6 October 2010 diff hist 0‎ m Opsin evolution: update blog ‎No edit summary
• 21:1021:10, 6 October 2010 diff hist +144‎ Opsin evolution: Neuropsin phyloSNPs ‎ →‎NEUR4: a fourth neuropsin from lamprey to platypus
• 21:0621:06, 6 October 2010 diff hist +29‎ m Opsin evolution: Neuropsin phyloSNPs ‎No edit summary
• 21:0521:05, 6 October 2010 diff hist +8‎ Opsin evolution: Neuropsin phyloSNPs ‎ →‎NEUR4: a fourth neuropsin from lamprey to platypus